Protein Info for PP_2456 in Pseudomonas putida KT2440

Annotation: D-ribose ABC transporter - permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 62 to 106 (45 residues), see Phobius details amino acids 108 to 150 (43 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 306 to 322 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 54 to 317 (264 residues), 180.4 bits, see alignment E=2e-57

Best Hits

Swiss-Prot: 30% identical to YTFT_ECOLI: Inner membrane ABC transporter permease protein YtfT (ytfT) from Escherichia coli (strain K12)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to ppf:Pput_3234)

MetaCyc: 30% identical to galactofuranose ABC transporter putative membrane subunit YtfT (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K36 at UniProt or InterPro

Protein Sequence (331 amino acids)

>PP_2456 D-ribose ABC transporter - permease subunit (Pseudomonas putida KT2440)
MKTTPLNNQDAAPVRRSGTYFGLGTYLGLAGALLAMIVLFSFLSSHFWSYGTFSTLANQI
PDLMVLAVGMTFVLIIGGIDLSVGSVLALAASTVSVAILGWGWGVLPSALLGMAVAALAG
SITGGVTVAWRIPSFIVSLGVLEMARGLAYQFTDSRTAYIGDAYAWFSNPVAFGVSPAFI
IALLVIVLAQLVLTRTVFGRYLIGIGTNEEAVRLAGIDPRPYKVLVFALMGLLAGLAALF
QISRLEAADPNAGSGLELQVIAAVVIGGTSLMGGRGSVISTFFGVLIISVLAAGLAQIGA
SEPTKRIITGAVIVIAVVLDTYRSRRAGRRN