Protein Info for PP_2443 in Pseudomonas putida KT2440

Annotation: Serine/threonine transporter SstT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 45 to 67 (23 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 287 to 313 (27 residues), see Phobius details amino acids 322 to 348 (27 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details PF00375: SDF" amino acids 13 to 392 (380 residues), 215.6 bits, see alignment E=5.8e-68

Best Hits

Swiss-Prot: 100% identical to SSTT_PSEPK: Serine/threonine transporter SstT (sstT) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K07862, serine/threonine transporter (inferred from 100% identity to ppu:PP_2443)

MetaCyc: 71% identical to serine/threonine:Na+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-22449; RXN0-4083

Predicted SEED Role

"Sodium:dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K49 at UniProt or InterPro

Protein Sequence (403 amino acids)

>PP_2443 Serine/threonine transporter SstT (Pseudomonas putida KT2440)
MTPFLRILNRTSLVTQIVIGLLAGIALALLAPAIARDLAFLGKVFVSALKAVAPVLVFIL
VMASVANHRHGQETHIRPILWLYLLGTFAAAVVAVFASMLFPSHLALSTSEATLSAPGGI
AEVLQNLLLNAVDNPVNALLNANFIGVLTWAIGLGVALRHAGETTRTVVEDLSNGVTLIV
RVVIRFAPLGIFGLVSSTLAQSGLDALLGYLHLLAVLIGCMLFVALVMNPLIVFWKIRRN
PYPLTLLCLRESGITAFFTRSSAANIPVNLALSERLGLHEDTYSVSIPLGATINMAGAAI
TITVLTLAAVHTLGIQVDLPTAVLLSVVAAVCACGASGVAGGSLLLIPLACSLFGIPSEI
AMQVVAVGFIIGVLQDSAETALNSSTDVLFTAAACQAQEQRHG