Protein Info for PP_2438 in Pseudomonas putida KT2440

Annotation: putative alcaline-induced transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 213 to 237 (25 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 16 to 322 (307 residues), 409.5 bits, see alignment E=4.8e-127 PF03741: TerC" amino acids 82 to 291 (210 residues), 188.7 bits, see alignment E=4.2e-60

Best Hits

KEGG orthology group: K05794, tellurite resistance protein TerC (inferred from 100% identity to ppu:PP_2438)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K53 at UniProt or InterPro

Protein Sequence (354 amino acids)

>PP_2438 putative alcaline-induced transporter (Pseudomonas putida KT2440)
MTALQSFLTTPVLGTSAWLWLVFMAIVIGLLVLDLGVLHRHDREIEMRESLLLYSGYFSV
GVLFGAGVWYQLGAQSALEFYTGFLVEQSLSMDNVFVMAMIFSYFAIPRRYQHRVLFWGI
LGVVFLRAIMIGVGAALVQNFAWVLYIFGAFLLFTGVKMALSKEDSRPDLANNPILKFVR
RHMRVTDQIHGSHFFVRHTPAGHSKALRYATPLFLALVLIELADLVFAVDSVPAIFAITQ
DPFIVYTSNIFAILGLRSLYFALAALMHRFVYLKYALALVLIFIGCKIFYHGMVGKVPAL
LSLGVTFGLLLGGVVISLIKTRGQTLNKDDKTIEKAANDKKTTGQKKNDPQLRV