Protein Info for PP_2425 in Pseudomonas putida KT2440

Annotation: putative transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF06719: AraC_N" amino acids 31 to 182 (152 residues), 133.6 bits, see alignment E=6.5e-43 PF00165: HTH_AraC" amino acids 204 to 245 (42 residues), 34.2 bits, see alignment 3.1e-12 PF12833: HTH_18" amino acids 217 to 292 (76 residues), 80.1 bits, see alignment E=1.8e-26

Best Hits

Swiss-Prot: 42% identical to YQHC_ECOLI: Uncharacterized HTH-type transcriptional regulator YqhC (yqhC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2425)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K66 at UniProt or InterPro

Protein Sequence (301 amino acids)

>PP_2425 putative transcriptional regulator, AraC family (Pseudomonas putida KT2440)
MQLTRHVDANAPLCSLIRSLTTRPGFVPTLLPQVQVLSWDHYVASSPQIYEPSLMIVAQG
SKLARLGPRTLEYGAGHYLVQALSVPFMCETFATREAPLLGVAVGIDRGVLGELVQSMGL
APDAEVQAQTPQSMTSAALDAPMRESVERLLHCLQDPLDAKVLGPARVREVLYTALRGPQ
AGVLRALVEQQGHFARIGAALAHLREHYAEPLSVEALAARANMSVSTFHEHFKRCTDMAP
MQYLKRLRLLKAQQMLIGEGLGVAQAAHRVGYQSTSQFSREYKRQFERSPGDELPYQSMP
V