Protein Info for PP_2417 in Pseudomonas putida KT2440

Annotation: putative Iron ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 67 to 87 (21 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 244 to 271 (28 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details PF01032: FecCD" amino acids 16 to 333 (318 residues), 283.1 bits, see alignment E=2.5e-88 PF00950: ABC-3" amino acids 108 to 313 (206 residues), 34.1 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to ppu:PP_2417)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K74 at UniProt or InterPro

Protein Sequence (339 amino acids)

>PP_2417 putative Iron ABC transporter, permease protein (Pseudomonas putida KT2440)
MMIRLLPCIAVALAALLAALLAGTAIGETNLSPSVVGQVLANHLWQAAYPVDPIDAGIVW
NYRLTRTLVAAACGAGLATCGVILQAMLRNPLAEPYLLGLSAGASTGAVLVGLLGLGSLA
LSMSAGAFIGAGAAFALVLVLARAAGPSSNNAQVILAGIAGSQLFNALTAFLITKSATAE
QARGILFWLLGNLSGVRWPSVWLAVPVAVFGLLVCLWHRRALDAFTFGADSAASLGIPVR
RTQLLLISCAALVTAVMVSIVGAIGFVGLVIPHALRLLLGPGHSRLLPASALGGALFLIV
ADILSRTLITGQVIPVGVVTALIGAPVFALILVSRRGRP