Protein Info for PP_2413 in Pseudomonas putida KT2440

Annotation: GGDEF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 305 to 328 (24 residues), see Phobius details PF02743: dCache_1" amino acids 73 to 291 (219 residues), 50.9 bits, see alignment E=2.4e-17 PF22309: HK-GC-Chemotax_sensor" amino acids 102 to 199 (98 residues), 30.7 bits, see alignment E=4.3e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 385 to 542 (158 residues), 147.9 bits, see alignment E=1.2e-47 PF00990: GGDEF" amino acids 389 to 540 (152 residues), 144.2 bits, see alignment E=4.7e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2413)

Predicted SEED Role

"Putative Heme-regulated two-component response regulator" in subsystem Putative hemin transporter or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K78 at UniProt or InterPro

Protein Sequence (544 amino acids)

>PP_2413 GGDEF family protein (Pseudomonas putida KT2440)
MSTAGQGNFRSAALYDHPRSGLTHTKHGLRLDLRTLILVLCALTAVVMLCASYFASYRVQ
RQLLIDNALEANRVYATKLASITETFIGNALQQLMFSASVQSRQLSDAAALQVESDRVLG
QSMAFNSTFVIDANGVLLAVSPAPLRHLVGTHVQSPGALEALHERRPLVSTPYLSAADNL
VVALSQPIFDRDGRYLGYVGGSLYLRERNILNSLLGEHFYKDGSYLYVVDRNRRLLYHPH
SERVGTVVEGNALIDQMATLDSGTRQLTNSLGVEMLAGFATVPSAGWGVVAQQPLVQTVA
PLHHLVLNVIASSAPLALVGSLLLWWLARTIARPLWKLAAGARTMDRAGTAEHLHQVRAW
YFEAAELKRALLFSLNLLQERIGRLNRDAQTDPLTGLGNRRSLEISLSLLEAEKREFAAI
ALDIDHFKRINDSHGHDVGDQVLRQLAELMRRCCREGDLLCRTGGEEFLILLPGATLNVA
AAVAERLRVTVQEMPVESVGAVTISLGVTHWDGETHGEPMSALGEADRALYRAKQEGRNR
VAFA