Protein Info for PP_2411 in Pseudomonas putida KT2440

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 111 to 111 (1 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 309 to 327 (19 residues), see Phobius details amino acids 333 to 357 (25 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 18 to 229 (212 residues), 94.1 bits, see alignment E=9.4e-31 amino acids 230 to 428 (199 residues), 46.7 bits, see alignment E=2.3e-16 PF07690: MFS_1" amino acids 20 to 386 (367 residues), 124.4 bits, see alignment E=5.1e-40

Best Hits

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 100% identity to ppu:PP_2411)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K80 at UniProt or InterPro

Protein Sequence (445 amino acids)

>PP_2411 Major facilitator family transporter (Pseudomonas putida KT2440)
MSAHHEVSPATLRRVIAASAIGNFVEWFDFAVYGFLATLIASQFFASEDASVALLKTFAV
FAVAFALRPLGGIVFGALGDRLGRKRILSLTILLMAGSTTLIGLLPTYASIGLAAPALLT
LARCLQGFSAGGEYAGACAYLMEHAPDDKRAFYGSFVPVSTFSAFACAAVIAYGLEASLS
TEAMNAWGWRIPFLIAAPLGLVGLYLRWRMEETPAFREAVAQGKEHEHSPLKETLRHHGR
VIRNLGAFISLTALSFYMFTTYFATYLQLVGNLTRAQSLLVTTVALLFAAVGCPLAGAFS
DRVGRRKTIGFTCLWVMLCVFPAYWLASSGSMSGALLGVILLAVGALCSGVVTAALLSES
FPTRTRYTASAITYNVAYTLFGGTAPLVATWLIAQTGSSLAPAFYLVVIALVALVGGLAL
PETSRISLHDDLGVDGVRAGARRAV