Protein Info for PP_2407 in Pseudomonas putida KT2440

Annotation: 3-dehydroquinate dehydratase 2, type II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 transmembrane" amino acids 114 to 133 (20 residues), see Phobius details TIGR01088: 3-dehydroquinate dehydratase, type II" amino acids 5 to 142 (138 residues), 200 bits, see alignment E=6e-64 PF01220: DHquinase_II" amino acids 5 to 140 (136 residues), 207.2 bits, see alignment E=3.9e-66

Best Hits

Swiss-Prot: 100% identical to AROQ2_PSEPK: 3-dehydroquinate dehydratase 2 (aroQ2) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03786, 3-dehydroquinate dehydratase II [EC: 4.2.1.10] (inferred from 100% identity to ppf:Pput_3288)

MetaCyc: 59% identical to periplasmic dehydroquinate dehydratase (Gluconobacter oxydans)
3-dehydroquinate dehydratase. [EC: 4.2.1.10]

Predicted SEED Role

"3-dehydroquinate dehydratase II (EC 4.2.1.10)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 4.2.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.10

Use Curated BLAST to search for 4.2.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K84 at UniProt or InterPro

Protein Sequence (149 amino acids)

>PP_2407 3-dehydroquinate dehydratase 2, type II (Pseudomonas putida KT2440)
MKPLILVLNGPNLNMLGTREPAQYGHETLADLAQGCADTAHAHGLEIEFRQTNHEGELID
WIHAARGRCAGIVINPGAWTHTSVAIRDALVASELPVIEVHLSNVHKREPFRHLSFVSSI
AVGVICGLGSHGYRMALSHFAELLQERAA