Protein Info for PP_2392 in Pseudomonas putida KT2440

Annotation: putative major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 253 to 278 (26 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details PF07690: MFS_1" amino acids 2 to 282 (281 residues), 111.7 bits, see alignment E=1.9e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2392)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K99 at UniProt or InterPro

Protein Sequence (347 amino acids)

>PP_2392 putative major facilitator family transporter (Pseudomonas putida KT2440)
MHISQAMAGQWVTAYALGSLLTAIPLVTLTQGWYRRRALLLAIIGFVLFNGLTALSNSNT
LTLVLRFFTGAAAGLAWGLIAGHARRMVPVPLQGRAMALAMLGQPIALSLGLPIATWLGA
GLGWRATFVVVTLVASQLVVWVLRSVPDYPGQAAGKRPAAMQVLRTPGVLIVLLVILTWI
LGHNILYTYIVPLLAAAGMAADIGPVLMVFGLSALAGIGLVGLLVDRHLRKLVLLSLAGF
ALATLALGQASSWLVYLSIALWGMTYGGAPTLLQTACADAAGQGGDVAQSMLVTVWNCAI
ALGGIIGGLLLAGAGVAWFGGVVLGLIALAWLLAVAGRGSGFVAGRR