Protein Info for PP_2388 in Pseudomonas putida KT2440

Annotation: Transporter, LysE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 63 (23 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details PF01810: LysE" amino acids 15 to 196 (182 residues), 63.1 bits, see alignment E=1.3e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_3307)

Predicted SEED Role

"Efflux protein, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KA2 at UniProt or InterPro

Protein Sequence (208 amino acids)

>PP_2388 Transporter, LysE family (Pseudomonas putida KT2440)
MNTALTATYALTVLLLIATPGPVVALIVNTAAASGSRKAMFTAVGTNWASLVLIGAAAWI
ILTSAAIDKTWLSTMSLLGCLFIGYIAVGTLRDALQAPASDAASEAPKAGRGGLMQGFMV
GISNPKDIIFFIAFFPQFIQITESFGKSMVVLSLLWVAIDFAVLSLYIFAIGKIASQRSN
RIISLASGVALLLIAAGGLLYNLKELAA