Protein Info for PP_2385 in Pseudomonas putida KT2440

Annotation: Branched-chain amino acid transport protein AzlC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 signal peptide" amino acids 1 to 12 (12 residues), see Phobius details amino acids 30 to 31 (2 residues), see Phobius details transmembrane" amino acids 13 to 29 (17 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details PF03591: AzlC" amino acids 18 to 156 (139 residues), 134.5 bits, see alignment E=1.8e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_3310)

Predicted SEED Role

"FIG00957710: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KA5 at UniProt or InterPro

Protein Sequence (230 amino acids)

>PP_2385 Branched-chain amino acid transport protein AzlC (Pseudomonas putida KT2440)
MPHIARQAFLHGAIAILPLSLAVAPWGLLAGSMAIEANLSAWQGQGLSAIVFAGAAQLVA
IGMLKGGANLASILLTTLLLTSQHLLYGLSMRPVLSSQPLRWRLGLGFLLTDEFFALTSQ
YDRQQFNRWYALGVGLTFYIAWNLFTLAGILLGQNIPHLDQFGLDFSIVATFVALIAPLV
RNLATVVCVAVSLFCSVLFSYWHWETALVVAGLLGMSAGFICQKFAGARA