Protein Info for PP_2377 in Pseudomonas putida KT2440

Annotation: putative acetyltransferase Act

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 187 to 204 (18 residues), see Phobius details amino acids 212 to 229 (18 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 3 to 309 (307 residues), 103.8 bits, see alignment E=5.1e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2377)

Predicted SEED Role

"Exopolysaccharide production protein ExoZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KB3 at UniProt or InterPro

Protein Sequence (344 amino acids)

>PP_2377 putative acetyltransferase Act (Pseudomonas putida KT2440)
MLYSLQALRAFAAWVVVCHHFMQIFFDFHATGPIGQLLTDRGAVGVDIFFVISGLVIYLS
TRDKTVEPRQFLLNRALRIVPAYWFYTALMAILLLAFSQWMPHQSFDWRHLFLSLLFIPA
ENPGGYGLYPTLNVGWTLNFEMFFYLLFGLAFLVRQRHHLLLVTAALLLVSEVLGRMGVV
SRFYNNDIIYEFLLGIGVGVLYRRGLIRQGRWLPLALLGVAGMAIYCLDASQRLLHWGLP
SAMIVLAFVAMEPLFQGNRLLKALGDCSYSVYLIHVLVLYAGWFASQRLHLNPFLTFALC
VPSIGLMSWFSYQWLERGLYRRMQAWLAAQRGPAPEYALSRVNC