Protein Info for PP_2349 in Pseudomonas putida KT2440

Updated annotation (from data): nitrite transporter, HPP family
Rationale: Specifically important in nitrogen source Sodium nitrite. Related to Synpcc7942_1745, which can be a nitrite uptake transporter (PMID:24904028). Besides the HPP domain, it encodes two cytoplasmic CBS domains, which might play a regulatory role.
Original annotation: CBS domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 77 to 94 (18 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details PF04982: TM_HPP" amino acids 20 to 174 (155 residues), 132.5 bits, see alignment E=1.1e-42 PF00571: CBS" amino acids 242 to 291 (50 residues), 45.9 bits, see alignment 5.8e-16 amino acids 315 to 365 (51 residues), 37.3 bits, see alignment 2.9e-13

Best Hits

KEGG orthology group: K07168, CBS domain-containing membrane protein (inferred from 100% identity to ppu:PP_2349)

Predicted SEED Role

"CBS domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KE1 at UniProt or InterPro

Protein Sequence (384 amino acids)

>PP_2349 nitrite transporter, HPP family (Pseudomonas putida KT2440)
MSASRSESRLQRLLPASLNIPPKEWLRAGIGALLGLFLAGWLTSLAYGPSIALHLLGPLA
ASAVLVFAVHSGPLAQPWPVLGSYALAGAVGLAMREGFGPELWVAAAALGISILVMCLLR
CLHPPGGGVAVSAVLADPGLTALGDHLLEPVLLNALILVTVAIAYNRLTGVRYPKGALPR
KDLHHTHDPLPGERVGIRSEDLDLALEELGEFVDVSRDELERIILATEQHALQRSLGGIT
AASVMSRDVQFATPDTTLEQAWKMLASHHLKTLPVLQHGKLVGIVSLSDLVGPAMQRGRF
SWRGLFGRQAVRMAQVMSRRVVSVSSQHPLERLLPLLCEQGLHCLPVLDGDKLVGVITQT
DLIAGLKRQLLSKIEASDNRVPAL