Protein Info for PP_2341 in Pseudomonas putida KT2440
Annotation: 6-carboxy-5,6,7,8-tetrahydropterin synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 76% identical to QUED_SHIFL: 6-carboxy-5,6,7,8-tetrahydropterin synthase (queD) from Shigella flexneri
KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 99% identity to ppf:Pput_3428)MetaCyc: 76% identical to 6-carboxy-5,6,7,8-tetrahydropterin synthase (Escherichia coli K-12 substr. MG1655)
RXN0-5507 [EC: 4.1.2.50]
Predicted SEED Role
No annotation
MetaCyc Pathways
- drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
- erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
- threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
- preQ0 biosynthesis (2/4 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.2.50 or 4.2.3.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88KE9 at UniProt or InterPro
Protein Sequence (118 amino acids)
>PP_2341 6-carboxy-5,6,7,8-tetrahydropterin synthase (Pseudomonas putida KT2440) MEIFKEFTFESAHRLPHVPEGHKCGRLHGHSFKVGLHLTGPLDPHTGWIRDFAEVKAIFK PIYDQLDHNYLNDIPGLENPTSEVIAKWIWDQVKPLMPELSKVRIHETCTSGCEYTGD