Protein Info for PP_2331 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 312 to 330 (19 residues), see Phobius details amino acids 334 to 351 (18 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 388 to 407 (20 residues), see Phobius details amino acids 414 to 432 (19 residues), see Phobius details amino acids 444 to 462 (19 residues), see Phobius details amino acids 468 to 488 (21 residues), see Phobius details PF14400: Transglut_i_TM" amino acids 25 to 184 (160 residues), 165.7 bits, see alignment E=8.8e-53 PF14402: 7TM_transglut" amino acids 260 to 505 (246 residues), 323.1 bits, see alignment E=1.2e-100

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2331)

Predicted SEED Role

"FIG139976: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KF9 at UniProt or InterPro

Protein Sequence (511 amino acids)

>PP_2331 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MRSLTLHLKVLITVLVLLGVAVTAYQIFVLGIPVTEDETDDLWNIDAKVEFVASSKDPVK
VQMFVPPLNRDYVSLNESFISNNYGVSINRADGNRKVTWSARRASGNQTLYYRLVLTKRY
SNEKTKVKGPTFRDSLAVEGPEKIAAEALMAPIRQHSADVETFVSETIKRVNNLNDDNVK
LLLAGDTSAMKKAQVIDLLLSIAHVPMEKVHTIRLLADTPQTPELWLRSFNGDDWLYFNP
DTGEQGLPSDRLLWWTGDDNLITVDGGKKATVTFSMNNSEMNAIRLAKLTDENTDADFLE
YSLYGLPLQTQQTFMIMVMIPIGVLVILVLRNLIGIQALGTFTPVLIALAFRETQLGFGI
MLFTVITALGLSLRSYLEHLKLQMLPRLSVVLTFVVVLIAAISLFSHKLGLERGLSVALF
PMVILTMTIERLSITWEERGGGHAMKVAIGTLFAASLAHLLMMVPELVYFVFTFPAVLLI
LVGFMLAMGRYRGYRLTELVRFKAFLNKADT