Protein Info for PP_2316 in Pseudomonas putida KT2440

Annotation: putative ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 832 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 260 to 283 (24 residues), see Phobius details amino acids 303 to 328 (26 residues), see Phobius details amino acids 348 to 374 (27 residues), see Phobius details amino acids 388 to 410 (23 residues), see Phobius details amino acids 416 to 440 (25 residues), see Phobius details amino acids 468 to 490 (23 residues), see Phobius details amino acids 708 to 729 (22 residues), see Phobius details amino acids 761 to 784 (24 residues), see Phobius details amino acids 796 to 816 (21 residues), see Phobius details PF02687: FtsX" amino acids 261 to 368 (108 residues), 26.7 bits, see alignment E=2.4e-10

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to ppu:PP_2316)

Predicted SEED Role

"FIG00809136: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KH4 at UniProt or InterPro

Protein Sequence (832 amino acids)

>PP_2316 putative ABC transporter, permease protein (Pseudomonas putida KT2440)
MPLSRLCGLALRQLLRDVRASEVRVLFFALLVAVAASTAIGYFGARLNGAMQLRASEFLG
ADLVLQGSAPAREQQLDAGKALGLRHARVVEFTSVVGGDNGIQLSSVKAADGAYPLRGQV
RSAPAPYAEETPGGGPAPGEVWVEPRLLAALGLAIGDSIDVGIKTLRMSRVLTYEPDRAN
NFYSLTPRVMMNLADLEATGVIQPGSRVTYRDLWRGDAEALAQYRQAVEKDLAANQRLRD
TRDGNQQIGGALGKAERYLNMASLVAVLLAGVAVALSASRYAARRLDASALLRCLGLSRH
QALGLYCLQLAMLGLVAALAGALLGWLAQLGLFRLLHGLLPSVVPAGGIVPALAGIGTGL
VALAGFALPPIAALGQVPPLRVLRRDLLPIPASSWLVYGAALLALGLIMWRLSLDLLLTF
ALLGGGLVAALLLGGLLLLGLRSLRQLLAGAPLTWRLGLGQLLRHPTAAAGQALAFGLIL
LAMALVALLRAELLDTWQAQLPKDAPNHFALNILPDDREPFIQHLHQVNAASAPLYPVTP
GRLVQINEKPVQQVVSKDSAGERAVQRDLSLTWAAELPEGNVLTAGSWWPALPADNDIPG
VSVEAELASSLKLQMGDLLTFDIGGQQRQARVSSLRNVHWDSFQPNFYMIFQPGTLQGLP
TTYLTSFYLAPGHDLDVVALSRAFPAVTILQVDALLDQLRSILAQVTLAVEYVLLFVLAA
GLAVLFAGLQATLDERIRQGALLRALGAARPLLVKARRIEFGLLGAASGLLAAVGCELIT
WVLYRYAFDLQWSPHPWLLVLPLTGALLVGGAGVLGTRRALNASPLAVLREA