Protein Info for PP_2315 in Pseudomonas putida KT2440

Annotation: Transcription elongation factor GreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 TIGR01461: transcription elongation factor GreB" amino acids 3 to 155 (153 residues), 257.6 bits, see alignment E=1.6e-81 PF03449: GreA_GreB_N" amino acids 5 to 74 (70 residues), 88.5 bits, see alignment E=2.8e-29 PF01272: GreA_GreB" amino acids 81 to 155 (75 residues), 89.4 bits, see alignment E=1.2e-29

Best Hits

Swiss-Prot: 100% identical to GREB_PSEPK: Transcription elongation factor GreB (greB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K04760, transcription elongation factor GreB (inferred from 100% identity to ppu:PP_2315)

Predicted SEED Role

"Transcription elongation factor GreB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KH5 at UniProt or InterPro

Protein Sequence (162 amino acids)

>PP_2315 Transcription elongation factor GreB (Pseudomonas putida KT2440)
MSTNIITTEGHEALKKELDHLWRVYRPEITQKVAWAASLGDRSENADYQYNKKLLREIDR
RVRYLRKRLEDVKVVAYSPEQEGKVFFGAWVEIENDEGETMKFRIVGYDEIYGRNDYISI
DSPMARALLKKEEGDEVVVHTPTGEATWYVSSIRYGQGVSTD