Protein Info for PP_2262 in Pseudomonas putida KT2440

Annotation: sugar ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 278 (195 residues), 63.6 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to ppf:Pput_3476)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KM8 at UniProt or InterPro

Protein Sequence (288 amino acids)

>PP_2262 sugar ABC transporter, permease protein (Pseudomonas putida KT2440)
MNNKVSNNKAWWLVLPVFLLVAFSAVVPMMTVVNYSVQDIFDQSSRYFVGADWYRQVLRD
PALHDALLRQFIYSACVLLIEIPLGIGIALAMPTKGRMASVCLIVMAIPLLIPWNVVGTI
WQIFGRADIGLLGASLAKLGVSYNYAGDPFDAWLTVLVMDVWHWTSLVALLCYSGLRAIP
DVYYQAARIDRASGWAVFRHIQLPKLKNVLVIALMLRFMDSFMIYTEPFVLTGGGPGNAT
TFLSQTLTRMAVGQFDLGPAAAFSLVYFLIILLVSWLFYTAMTHADKD