Protein Info for PP_2261 in Pseudomonas putida KT2440

Annotation: Sugar ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF00005: ABC_tran" amino acids 33 to 168 (136 residues), 81.2 bits, see alignment E=1.7e-26 PF17912: OB_MalK" amino acids 242 to 290 (49 residues), 36.6 bits, see alignment 1e-12

Best Hits

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to ppu:PP_2261)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KM9 at UniProt or InterPro

Protein Sequence (365 amino acids)

>PP_2261 Sugar ABC transporter, ATP-binding protein (Pseudomonas putida KT2440)
MAEIRLRQLAHSYSRQPASEADYALHALEHVWEQGGAYALLGPSGCGKSTLLNIISGLLT
PSHGEVLFDGKPVNQLSPQARNIAQVFQFPVVYDTMTVFDNLAFPLRNQGLDEARVRARV
EEIAEVLELTAVLRKKARNLTADEKQKVSMGRGLVRDDVSAILFDEPLTVIDPHLKWKLR
RKLKQIHEQFNITMIYVTHDQLEASTFADKIAVMHGGRIVQFGTPRELFERPRHTFVGYF
IGSPGMNLIDVRAEAGAVVFGDVQLVLPDGLCERLASLAGGRLQVGIRPEFVQLWDSPFE
GAYPARVLDVEDLGTYRIVTLELGGVALKARLGEDRPLPVDQTWVSLPAQWLMLYVDDVL
LETGP