Protein Info for PP_2248 in Pseudomonas putida KT2440

Annotation: putative transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 5 to 8 (4 residues), see Phobius details amino acids 24 to 24 (1 residues), see Phobius details transmembrane" amino acids 9 to 23 (15 residues), see Phobius details amino acids 33 to 58 (26 residues), see Phobius details amino acids 79 to 104 (26 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 215 to 239 (25 residues), see Phobius details amino acids 260 to 286 (27 residues), see Phobius details amino acids 298 to 320 (23 residues), see Phobius details amino acids 326 to 343 (18 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_3490)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KP2 at UniProt or InterPro

Protein Sequence (354 amino acids)

>PP_2248 putative transporter (Pseudomonas putida KT2440)
MQEQLKIAGAFVGVIVGAGFASGRELLLFFVDFGVWGLAGALVSAALFTFLGMALAGLGN
RQQATSHKDVILAICGRHLGMFVDWLITFFMFAVTVVMLAGGGALLEQQFGIPALTGSVL
VTLVVVGIVCLDVRKMMLAIGAITPLLILVASAIALYAVITREQSFAALDQVASQQQAGT
RHWLLGAFLYVSYNIVAGAPILAILGGSAKGEKAAVWGGLLGGAALGGLMLVMSAGLLSR
LDSVADQPMPMLSIANEVSPLLGLVMCLIIFGMIVNTAVGTLFSFLSRLLPAGTTKFRWG
SVVTGVVALGCSLVGFISLVGEVYPFFGYLGFVLMTAVLLAWVRRGRAAKAVAA