Protein Info for PP_2241 in Pseudomonas putida KT2440

Annotation: putative major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 315 to 338 (24 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 270 (245 residues), 86.3 bits, see alignment E=2e-28 amino acids 251 to 393 (143 residues), 52.1 bits, see alignment E=5.1e-18 PF00083: Sugar_tr" amino acids 54 to 195 (142 residues), 24.5 bits, see alignment E=1.2e-09 amino acids 264 to 398 (135 residues), 28.3 bits, see alignment E=8.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2241)

Predicted SEED Role

"Major facilitator superfamily protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KP9 at UniProt or InterPro

Protein Sequence (399 amino acids)

>PP_2241 putative major facilitator family transporter (Pseudomonas putida KT2440)
MRGDDNSCANTAKSPPKMPRSIWALGFVSMLMDISSEMIHALLPLYMVSVLGASVIAVGL
VEGIAESTASFTKVFSGALSDRLGKRKLLTVLGYGLSALMKPVFPMAPGLEWLTAARFVD
RVGKGIRGGPRDALVADVTPVELRGAAFGLRQALDTVGAILGPLLAIVLMWLTASHFQTV
FWVAVIPAFVAVYILIAFVHEPAAPAMGHPVRSPLALHELRRLGPVYWRLIGLATLFTLA
RFSEAFLLLRAQNIGLTPLWAPAVLVLMAMAYSLSAYPAGVLSDRVGRRGVLMGGLGLLI
TADLLLALLPGWVGLAFGVTAWGLHLGFSQGIFSAMIADSAPANLRGTAFGLFNLLTGAA
LLIASVVAGLLWERAGFQATFLVGAGFAVTTLAGLTLLR