Protein Info for PP_2208 in Pseudomonas putida KT2440

Annotation: phosphonoacetaldehyde hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR01422: phosphonoacetaldehyde hydrolase" amino acids 8 to 260 (253 residues), 375.4 bits, see alignment E=1.1e-116 PF00702: Hydrolase" amino acids 10 to 201 (192 residues), 60.4 bits, see alignment E=1.6e-20 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 73 to 206 (134 residues), 43.2 bits, see alignment E=4.5e-15

Best Hits

Swiss-Prot: 100% identical to PHNX_PSEPK: Phosphonoacetaldehyde hydrolase (phnX) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K05306, phosphonoacetaldehyde hydrolase [EC: 3.11.1.1] (inferred from 100% identity to ppu:PP_2208)

MetaCyc: 82% identical to phosphonoacetaldehyde hydrolase subunit (Pseudomonas aeruginosa)
Phosphonoacetaldehyde hydrolase. [EC: 3.11.1.1]

Predicted SEED Role

"Phosphonoacetaldehyde hydrolase (EC 3.11.1.1)" in subsystem Phosphonate metabolism (EC 3.11.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KT1 at UniProt or InterPro

Protein Sequence (275 amino acids)

>PP_2208 phosphonoacetaldehyde hydrolase (Pseudomonas putida KT2440)
MNYNNPTQLQAAILDWAGTVVDFGSFAPTQIFVEAFAEFDVQVSIEEARGPMGMGKWDHI
RTLCDVPEIAERYRKVFGRTPTDDDVTAIYNRFMPLQIEKIAVHSALIPGALDTLTGLRQ
DGLKIGSCSGYPKVVMDKVVELAAQNGYVADHVVATDETPNGRPWPAQALANVIALGIDD
VAACVKVDDTVPGILEGRRAGMWTVALVCSGNALGLTWEGFRALSAEKLESERQRIHALF
AGSRPHYLIDTINDLPEVIADINRRLAKGEMPQAF