Protein Info for PP_2204 in Pseudomonas putida KT2440

Annotation: copper resistance protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF05275: CopB" amino acids 89 to 294 (206 residues), 264.7 bits, see alignment E=2.8e-83

Best Hits

Swiss-Prot: 53% identical to COPB_PSEUB: Copper resistance protein B (copB) from Pseudomonas syringae pv. tomato

KEGG orthology group: K07233, copper resistance protein B (inferred from 100% identity to ppu:PP_2204)

Predicted SEED Role

"copper resistance protein B precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KT5 at UniProt or InterPro

Protein Sequence (294 amino acids)

>PP_2204 copper resistance protein B (Pseudomonas putida KT2440)
MNDTRNRSFVAGVALLTLLASERAMAAGSEHTNHGQMGHQAMPINHESMGHDQPSPSQPR
TPLPVITDADRRAAFPPLPGHQAHDRALNWAVIVDKLEYQNFESSSALNWNATAWVGGDI
DRLWLRTEGEREQGKTHKAELQALWGHAVSPWWELVAGARQDFKPASGQTWAAFGIQGTP
LYGLELQATAYAGERQQTALRLEAAYAMLLTNRWILEPTLEANLYGRNDAGREQGAGLAD
SEVGLRLRYEITRGFAPYVGLSFNRLHGSRANQAREDGEDLGQTRLVAGIRLRF