Protein Info for PP_2196 in Pseudomonas putida KT2440

Annotation: agmatinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 TIGR01230: agmatinase" amino acids 33 to 299 (267 residues), 248.8 bits, see alignment E=4.1e-78 PF00491: Arginase" amino acids 34 to 299 (266 residues), 323.7 bits, see alignment E=5.6e-101

Best Hits

Swiss-Prot: 60% identical to SPEB_CHRVO: Agmatinase (speB) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 100% identity to ppu:PP_2196)

MetaCyc: 56% identical to agmatinase (Escherichia coli K-12 substr. MG1655)
Agmatinase. [EC: 3.5.3.11]

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.3.11

Use Curated BLAST to search for 3.5.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KU3 at UniProt or InterPro

Protein Sequence (311 amino acids)

>PP_2196 agmatinase (Pseudomonas putida KT2440)
MTRDSLYGTAAESTYAGVVSFSRRRYSRDLRGVDVVVSGVPFDTATSNRPGARFGPRAIR
AASVQQAWARHWPWAFDPFDHLAVIDYGDCPFDSGTPQSVPDSIEAHAEHILQAGCAMLT
LGGDHFISYPLLKAHARRHGPLALIHFDAHSDTWPDEAGKRIDHGTMFWHAAREGLVDPA
HSVQIGLRTTNDDSQGFAILDARQVHRQGTEAVIAAIRQRVGERPVYLTFDIDCLDPAYA
PGTGTPVCGGLSTVQALEILGGLRGINLVGMDLVEVAPAYDHADITALAGATLAMEMLCL
YAARHKVDNGQ