Protein Info for PP_2192 in Pseudomonas putida KT2440

Annotation: putative RNA polymerase sigma-70 factor, ECF subfamily/transmembrane sensor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 170 to 187 (18 residues), see Phobius details TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 13 to 166 (154 residues), 85.7 bits, see alignment E=1.4e-28 PF04542: Sigma70_r2" amino acids 13 to 79 (67 residues), 37.6 bits, see alignment E=4.6e-13 PF08281: Sigma70_r4_2" amino acids 111 to 163 (53 residues), 56.1 bits, see alignment 6.9e-19 PF04545: Sigma70_r4" amino acids 116 to 164 (49 residues), 36.9 bits, see alignment 6.2e-13 PF22233: PhyR_sigma-like" amino acids 119 to 161 (43 residues), 29.4 bits, see alignment 1.7e-10 PF04773: FecR" amino acids 195 to 276 (82 residues), 55.5 bits, see alignment E=2e-18 PF16344: FecR_C" amino acids 305 to 364 (60 residues), 26.7 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_3545)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KU7 at UniProt or InterPro

Protein Sequence (374 amino acids)

>PP_2192 putative RNA polymerase sigma-70 factor, ECF subfamily/transmembrane sensor protein (Pseudomonas putida KT2440)
MLTSPMSGLLASFQEHYDDLLQFLTRRMSDRQRAADVAQETYLKLVNIDEQAVPVLHARS
FIFRVAGNLAIDALRREQRIAASHDDSDGACEVACPAPAPEAALLARERLQILDQALLQL
PDNARQALLLNRVEGLTQKQVAQRLGVSESMVAKYIGQALRHCRGRLKQAGVAASVVLLV
AAVAGWQQAPILLADYHTAVGERQVITLTDGTRVTLNSASALSVAFSEHERRVVLDAGEA
LFETADDSRPFVVETAGARVQGNAATFSVQRDGHVVLARGEAKVGEHELAVAADAGTQMA
WQRGKLIFNGKPLGQVLTELERYRHGRIVLSDSKLAAMEVSGVFDLDEPEALLRTLEQRY
GLKVTYLPWLAVVH