Protein Info for PP_2170 in Pseudomonas putida KT2440
Annotation: putative enzyme, chorismate mutase family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K04782, isochorismate pyruvate-lyase [EC: 4.1.3.-] (inferred from 100% identity to ppu:PP_2170)Predicted SEED Role
"Isochorismate pyruvate-lyase (EC 4.-.-.-)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 4.-.-.-)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Biosynthesis of type II polyketide backbone
- Photosynthesis - antenna proteins
- Porphyrin and chlorophyll metabolism
- Pyruvate metabolism
- Vitamin B6 metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.1.3.-
Use Curated BLAST to search for 4.-.-.- or 4.1.3.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88KW9 at UniProt or InterPro
Protein Sequence (232 amino acids)
>PP_2170 putative enzyme, chorismate mutase family protein (Pseudomonas putida KT2440) MATIRARKKADSTVSYTVQIRLKKKGVLVYQRSQTFARQQAAQAWATDGWRGGSAFSRSA PRRCEQVIRNGLGILRVSRVSGHRDGHSLRRYTPSVEREADLAQKLHCTPRSPTTACSNQ SQAHEKEVMQMDVPCTSLDEVRQRIDEIDRSLVSLLAKRGRLVTQAAGFKKTTDDVRAPA RVEQVIKKAREMADETGASAEVVEQVYRAMISAFIAEELNTHAKLADEASAS