Protein Info for PP_2157 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 157 to 177 (21 residues), see Phobius details PF21085: CusS" amino acids 3 to 151 (149 residues), 28.2 bits, see alignment E=4.6e-10 TIGR01386: heavy metal sensor kinase" amino acids 4 to 446 (443 residues), 496.1 bits, see alignment E=5.5e-153 PF00672: HAMP" amino acids 175 to 227 (53 residues), 42.8 bits, see alignment 1.3e-14 PF26769: HAMP_PhoQ" amino acids 181 to 227 (47 residues), 28.2 bits, see alignment 3.7e-10 PF00512: HisKA" amino acids 233 to 298 (66 residues), 55.2 bits, see alignment E=1.5e-18 PF02518: HATPase_c" amino acids 341 to 447 (107 residues), 77.2 bits, see alignment E=3.3e-25

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 100% identity to ppu:PP_2157)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KY2 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PP_2157 Sensor histidine kinase (Pseudomonas putida KT2440)
MMRRVSLGSRLALLFAACTATVSLGAGLLFSRASEQHFVELDQQLLDSRLSLFRTQLAGV
STADELQARLPALRDELSHQADLALRISASNGATWFESRSGLPHAAQATGLATLHAPGID
YRSLSVPLTQGAMQSPRLTLYLDITHHQHFLQGMQRLIWLTVGLSALITALLGAWAARSG
LRPLRQMGQVAASVSARSLTTRLPVAQMPEELAELASSMNAMLQRLDDAFQRLSAFSADI
AHELRTPLSNLLTHTQVTLTRPRSLEEYREALHGNLEELQWMAQMINDMLFLAKADHGLL
VPGDAPLALHDEVDALLEYYAPLAEDSDVQMLREGEAVLHGDQHMLRRALSNLLDNAMRF
TPAGGQIKVTLGPGPTINVANTGLAIDPAALPRLFDRFYRVDPARREGSSEHAGLGLAIT
RSIVQAHGGCIRAECEGGWTRFVIEFTQDR