Protein Info for PP_2130 in Pseudomonas putida KT2440

Annotation: putative Soluble lytic transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF14718: SLT_L" amino acids 418 to 485 (68 residues), 65.2 bits, see alignment E=7.6e-22 PF01464: SLT" amino acids 501 to 611 (111 residues), 109 bits, see alignment E=1.7e-35 PF27553: SLT_superhelical" amino acids 616 to 642 (27 residues), 47.8 bits, see alignment (E = 1.4e-16)

Best Hits

KEGG orthology group: K08309, soluble lytic murein transglycosylase [EC: 3.2.1.-] (inferred from 100% identity to ppu:PP_2130)

Predicted SEED Role

"Soluble lytic murein transglycosylase precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L07 at UniProt or InterPro

Protein Sequence (657 amino acids)

>PP_2130 putative Soluble lytic transglycosylase (Pseudomonas putida KT2440)
MLAPPTLPMVQLPGRIMRSRLLHIASCLLLTAATCAAQATDLTLQRQYYDEAKRALAKGD
KGPYLRYAQALSDYPLTPYLAYDELTARLKSASNQEIEGFLAKHGDLPQANWMKLRWLRW
LAERGEWDTFVKYYDPKLNFTELDCLNGQYQLSHGLRAEGYATADKLWNVGKSQPAACDT
LFGMWAAEGQLTEAKRWERTKLAAQARNYGLANTLVKTLTTLGPQGRLLIDVAQKPELLN
QPSRFTPVNEAMSDVVSLGLRRLARQNPERAMALLDDYAQRMHFSGDEKVAIAREIGLTL
ARRYDPRALDLMTRYDPQLRDNTVSEWRLRLLLRLGRWEDAYELTKRLPQDLASTSRWKY
WQARSLELAQPNNPQVPLLYKAAARERDFYGFLAADRAQTPYQLNNKPLLLSPQLVKKVR
NTPGIQRALEFHARGQIVDGRREWYHVSRHFTRDEMVAQARLGYELRWYFPAIRTISQAR
YWDDLDIRFPMAHRDTLVREAKVRGLHSSWVFAITRQESAFMEDARSPVGASGLMQLMPA
TAKETARKFSIPLASPAQVLNPDKNIQLGAAYLSQVHSQFNGNRVLASAAYNAGPGRVRQ
WLKGAKHLSFDVWVESIPFDETRQYVQNVLSYSVIYGQKLNSPQPLVDWHERYFDDM