Protein Info for PP_2126 in Pseudomonas putida KT2440

Annotation: DNA-binding response regulator, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF00072: Response_reg" amino acids 6 to 116 (111 residues), 94 bits, see alignment E=1e-30 PF00196: GerE" amino acids 154 to 209 (56 residues), 61 bits, see alignment E=1e-20 PF08281: Sigma70_r4_2" amino acids 155 to 197 (43 residues), 26.3 bits, see alignment 7e-10

Best Hits

Swiss-Prot: 35% identical to UVRY_SHIFL: Response regulator UvrY (uvrY) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_3615)

Predicted SEED Role

"DNA-binding response regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L11 at UniProt or InterPro

Protein Sequence (219 amino acids)

>PP_2126 DNA-binding response regulator, LuxR family (Pseudomonas putida KT2440)
MTCRLLLVDDHSLIRAGVRALVCDIPGYDVVGEADDGNQLLDQVRTLAPDIILLDISMRS
TSGLDALTQLRASGSTCKVLILSMHTDPDLIMRALESGAHGYLLKDTSATELEQALGAVR
HGERYLSPAIAHTVINQALRHTKQGKPSAGERHNLTSRQLEILRLIVRGKSTREIAAGLG
LSIKTVETHRSQIMKRLQIHDVAGLVLFAVREKIISLDD