Protein Info for PP_2106 in Pseudomonas putida KT2440

Annotation: putative Ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 197 to 221 (25 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 316 to 339 (24 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details PF00909: Ammonium_transp" amino acids 19 to 395 (377 residues), 285.3 bits, see alignment E=3.3e-89

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_3633)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L29 at UniProt or InterPro

Protein Sequence (402 amino acids)

>PP_2106 putative Ammonium transporter (Pseudomonas putida KT2440)
MENMHSAMDSLVHGSNTLFILMGAILVLAMHAGFAFLEVGTVRHKNQVNALSKILSDFAI
SALVYFFIGYWIAYGVNFFQPATTLAVDHGYALVKCFFLLTFAAAIPAIISGGIAERARF
VPQLCATALIVAFVYPFFEGVVWNGNLGLQAWLQARFGAPFHDFAGSVVVHAMGGWLALA
AVLLLGARRGRYRDGRLVAFAPSSIPFLALGSWILIIGWFGFNVMSAQTLQGVSGLVAIN
SLMAMVGGTLSALLAGRNDPGFLHNGPLAGLVAICAGSDLMHPVGALATGLVAGALFVWT
FTAAQNRWKIDDVLGVWPLHGLCGVWGGIACGVFGQVALGGMGGVSLVSQLLGSLMGVLV
ALAGGFAVYGAIRALHGLRLSHEQEFQGADLSLHRIGATSQD