Protein Info for PP_2097 in Pseudomonas putida KT2440

Annotation: Sensory box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 316 to 339 (24 residues), see Phobius details PF03924: CHASE" amino acids 88 to 273 (186 residues), 95.4 bits, see alignment E=1.4e-30 PF13188: PAS_8" amino acids 368 to 423 (56 residues), 16.8 bits, see alignment 1.9e-06 PF00989: PAS" amino acids 369 to 496 (128 residues), 32.9 bits, see alignment E=2e-11 PF08448: PAS_4" amino acids 378 to 501 (124 residues), 33.8 bits, see alignment E=1.2e-11 TIGR00229: PAS domain S-box protein" amino acids 378 to 506 (129 residues), 42.6 bits, see alignment E=6.3e-15 PF13426: PAS_9" amino acids 381 to 498 (118 residues), 32.3 bits, see alignment E=3.5e-11 PF08447: PAS_3" amino acids 539 to 616 (78 residues), 34 bits, see alignment E=1e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 638 to 796 (159 residues), 155.1 bits, see alignment E=1.4e-49 PF00990: GGDEF" amino acids 642 to 794 (153 residues), 147.8 bits, see alignment E=8.6e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2097)

Predicted SEED Role

"CHASE domain/PAS domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L38 at UniProt or InterPro

Protein Sequence (800 amino acids)

>PP_2097 Sensory box protein (Pseudomonas putida KT2440)
MSKCGVRARLLGLCTERASAWAMALIALVAGGLLTAALAFAAHTFYKQQLRQRFELLASE
RASRIAERFDEQQQRLDGLRRFFSFSSEITPREFDGYARPLLQRTLAYAWAPRVEAAQRA
EFERLASAHTGPGYVIRDQDAQGQWRPASQRDHYFPVLYTQSSERPGLPYGLDLAGQSEP
QAALARALAPALAPGSMAVSEPLALFDTQSAERGLLMVAPVFSDADPRGAAVGYVMALLS
MRELVSDGRPVAVDDNLVVRITDPSGLQGPVVLFDSQNPVAPLALASNQLLRLADHHFQL
SIQPSQAFAQANRSSAVMAVGLLGGLLSLLLSVLLYSLFSQRQRALALVAQRTAELQVSE
QSLRGTHNQLRSVLDAATQVAIIATNLKGVVSTFNAGAERMLGYAASEAIGRLRLEDLVL
PEELNLRAQALSLRFGRAIAGGQAMFAETVQEHGAEPGEWTLLRADGSQLVANMLVTAML
DEQGLWVGYLAICIDVTERRRVHEALAARDRLLEKLSAEVPGGIYQYRLDANGHSCFPYA
SMGLYDIYEIDLMQLREDASAVFERIHPDDLERVRRSVRYSAEHLSPWREEYRVCLPRAG
LRWVRGEATPEVGEQGCTLWHGYLTDISDLKGVEEELRALSVTDSLTGIHNRRYFQERLK
IELERAQRDGLPLAVIMLDIDHFKRINDRFGHAVGDRVLRSLCQRIAQRLRRTDVFCRLG
GEEFMVLCPGSDANQARLLALELWQGVRNVPVEGVGQVTASFGVAGWRSGEGADALLLRA
DAGVYAAKQAGRDRVEGEPV