Protein Info for PP_2096 in Pseudomonas putida KT2440

Annotation: fused 23S rRNA m2G2445 methyltransferase and 23S rRNA m7G2069 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 745 PF22020: RlmL_1st" amino acids 21 to 76 (56 residues), 62.9 bits, see alignment 5.5e-21 PF02926: THUMP" amino acids 85 to 171 (87 residues), 63.4 bits, see alignment E=5.2e-21 PF01170: UPF0020" amino acids 180 to 395 (216 residues), 144.9 bits, see alignment E=6.3e-46 PF10672: Methyltrans_SAM" amino acids 503 to 698 (196 residues), 72.1 bits, see alignment E=1.2e-23 PF03602: Cons_hypoth95" amino acids 579 to 668 (90 residues), 27.4 bits, see alignment E=6.5e-10

Best Hits

Swiss-Prot: 100% identical to RLMKL_PSEPK: Ribosomal RNA large subunit methyltransferase K/L (rlmL) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K12297, ribosomal RNA large subunit methyltransferase L [EC: 2.1.1.173] (inferred from 100% identity to ppf:Pput_3643)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmL EC 2.1.1.-)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.173

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L39 at UniProt or InterPro

Protein Sequence (745 amino acids)

>PP_2096 fused 23S rRNA m2G2445 methyltransferase and 23S rRNA m7G2069 methyltransferase (Pseudomonas putida KT2440)
MRRPVSQIAQGAGILMSDRFELYLTCPKGLESLLAEEAKGLGLDEVREHTSAIRGAADME
TAYRLCVWSRLANRVLLVLKRFSMKNADDLYDGVHAVDWADHLAADGTLAVEFSGHGSGI
DNTHFGALKVKDAIVDKLRNREGLRPSVEKIDPDVRVHLRLDRGEAILSLDLSGHSLHQR
GYRLQQGAAPLKENLAAAVLIRAGWPRIAAEGGALADPMCGVGTFLVEAAMIAADIAPNL
KRERWGFSAWLGHVPALWRKVHDEAQARAQAGLAKPPLWIRGYEADPRLIQPGRNNVERA
GLGDWVKIYQGEVSTFEPRPDQNQKGLVISNPPYGERLGDEASLLYLYQNLGERLRQACM
GWEAAVFTGAPQLGKRMGIRSHKQYAFWNGALPCKLLLFKVQPDQFVTGERREAQPEGTE
ARQQVPQASEPARLSEGAQMFANRLQKNLKQLGKWARREQIDCYRLYDADMPEYALAVDL
YQDWVHVQEYAAPRSVDPDKAQARLLDALAAIPQALGISPQRVVLKRRERQSGTRQYERQ
ATEGRFQEVNEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQREAAGKRFLNLFCYTATATV
HAAKGGARSTTSVDLSKTYLDWARRNLALNGYSERNRLEQSDVMTWLEGNRDSYDLIFID
PPTFSNSKRMEGVFDVQRDHVQLLDLAMARLAPGGVLYFSNNFRKFQLDEHLMARYVVEE
ISAQTLDPDFARNNRIHRAWRLQLR