Protein Info for PP_2088 in Pseudomonas putida KT2440

Annotation: RNA polymerase sigma factor SigX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 35 to 189 (155 residues), 108.1 bits, see alignment E=1.8e-35 PF04542: Sigma70_r2" amino acids 39 to 106 (68 residues), 74.5 bits, see alignment E=7.1e-25 PF04545: Sigma70_r4" amino acids 139 to 188 (50 residues), 46.5 bits, see alignment E=3.2e-16 PF08281: Sigma70_r4_2" amino acids 143 to 186 (44 residues), 30.9 bits, see alignment 2.6e-11

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to ppu:PP_2088)

Predicted SEED Role

"DNA-directed RNA polymerase specialized sigma subunit, sigma24-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L47 at UniProt or InterPro

Protein Sequence (196 amino acids)

>PP_2088 RNA polymerase sigma factor SigX (Pseudomonas putida KT2440)
MNKVHSPPMRYDPRELTDEELVARSHEELYHVTRAYEELMRRYQRTLFNVCARYLGNDRD
ADDVCQEVMLKVLYGLKNFEGKSKFKTWLYSITYNECITQYRKERRKRRLMDALSLDPVE
EASEDKAPKPEEKGGLDKWLVHVNPIDREILVLRFVAELEFQEIADIMHMGLSATKMRYK
RALDKLREKFAGLDET