Protein Info for PP_2085 in Pseudomonas putida KT2440

Annotation: CmaX protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 272 to 294 (23 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details PF01544: CorA" amino acids 41 to 328 (288 residues), 193.6 bits, see alignment E=2.4e-61

Best Hits

Swiss-Prot: 31% identical to ZNTB_YERE8: Zinc transport protein ZntB (zntB) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 100% identity to ppf:Pput_3655)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L50 at UniProt or InterPro

Protein Sequence (332 amino acids)

>PP_2085 CmaX protein (Pseudomonas putida KT2440)
MMFEEDNAQWGLVHALVLDGKGGARSIARTELDDLQLQPEQSLWLHWDRSHPQTRSWLLH
DSGLSEFACELLLEENTRPRLLPMADEQLLLFLRGVNLNPGAEPEDMVSVRIFAEAQRVI
SLRLRPLRASDEILQLLEQGRGPKSASELLLLMGELLTEKVQGLVSDLAELVDLEEEKVE
SDERYAPEQGSLQQIRRRAAGLRRFLAPQREIYAQLSRSKWSWFANADADYWNELNNSLI
RYLEELELARERAALVLESEDRRRSERMNRTMYRFGIITCIFLPMSFVTGLLGINVGGIP
GAENPLGFLFACIVVLGLAVGQWWLFRRLRWV