Protein Info for PP_2083 in Pseudomonas putida KT2440

Annotation: putative Lipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 57 to 151 (95 residues), 53.3 bits, see alignment E=5.1e-18 PF12697: Abhydrolase_6" amino acids 58 to 270 (213 residues), 54.3 bits, see alignment E=4.6e-18 PF12146: Hydrolase_4" amino acids 78 to 176 (99 residues), 40.9 bits, see alignment E=2.3e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2083)

Predicted SEED Role

"Esterase/lipase/thioesterase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L52 at UniProt or InterPro

Protein Sequence (330 amino acids)

>PP_2083 putative Lipase (Pseudomonas putida KT2440)
MQSSSTLFPVALLSAERRGDLSEDVYRIKAGNGPDPSVELAITRLGLADQAQAQGVPVIL
LHGSFSNRRFWYSPKGVGLGAYLARAGFDVWIPEMRGHGLSPRNHDWKHNSVAAYARDDL
PLINAFVREQSGQAPHWVGHSLGGTTLVAALGGGFLAAEQLASVALFGTQISRVYWPLKV
PPLAWGAKLVLKRWGQISGPRFKRGPEDEPIGLALESMRWHGLFGRFGDKQNDWWAGLAE
VDVPLLAVAGAGDFQDPVWACRKLFEQLGGERKQFLRLGREEGFEAFGHVDMLVSKAAQV
QVWPLVERWLHNPLLPVHASTVVAEPVPAS