Protein Info for PP_2081 in Pseudomonas putida KT2440

Annotation: putative phosphoenolpyruvate synthase regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF03618: Kinase-PPPase" amino acids 6 to 262 (257 residues), 266 bits, see alignment E=2.1e-83

Best Hits

Swiss-Prot: 100% identical to PSRP_PSEPK: Putative phosphoenolpyruvate synthase regulatory protein (PP_2081) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K09773, hypothetical protein (inferred from 99% identity to ppg:PputGB1_1592)

Predicted SEED Role

"FIG137360: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L54 at UniProt or InterPro

Protein Sequence (272 amino acids)

>PP_2081 putative phosphoenolpyruvate synthase regulatory protein (Pseudomonas putida KT2440)
MKRTAFFISDGTGITAETLGQSLLAQFESIPFNKFTRPYIDSPDKARVMVQQINAAAERD
GVRPIIFDTIVNQDIREILATSNGFMIDIFSSFLSPLEQELIAHSSYSVGKSHSIGGNSN
YMERIEAVNFALDNDDGARTHYYDKADLILVGVSRCGKTPTCLYMAMQFGIRAANYPLTE
DDMERLQLPAVLKKHHSKLFGLTIDPDRLTAIRHERKPNSRYSSFAQCEFEVREVESLFR
RENIPNINSTHFSVEEISAKILVEKGVERRFK