Protein Info for PP_2056 in Pseudomonas putida KT2440

Annotation: C4-dicarboxylate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 186 to 211 (26 residues), see Phobius details amino acids 217 to 244 (28 residues), see Phobius details amino acids 298 to 298 (1 residues), see Phobius details amino acids 303 to 337 (35 residues), see Phobius details amino acids 348 to 372 (25 residues), see Phobius details PF00375: SDF" amino acids 7 to 397 (391 residues), 359.7 bits, see alignment E=1e-111

Best Hits

Swiss-Prot: 58% identical to DCTA_LARHH: C4-dicarboxylate transport protein (dctA) from Laribacter hongkongensis (strain HLHK9)

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_3684)

MetaCyc: 55% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"C4-dicarboxylate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L79 at UniProt or InterPro

Protein Sequence (435 amino acids)

>PP_2056 C4-dicarboxylate transport protein (Pseudomonas putida KT2440)
MRLAKSLYFQILCAVLLGVVVGHFWAQQAVALKPLGDAFIKLIKMMIAPVVFCTIVTGIA
GMTDKRSLGRLMSKTLLLFLGLTVVSLVIGLAAVYLFKPGAGMNIDPATLSTAGLSQYTA
SAAKLSVVDFFMHIIPDTFIGAFNKGEVLPVLFIAVLSGFALSSMGEKGKPVLDVLESAS
TMVFRIFGYLMRFAPIGAFGALAFTVGQYGITSLGALAKLVGTLYIACAFFVLVVLGGIC
RAHGFSLWKLLRYFREEFLVVLGTSSTEPVLPRMLEKLEKLGCKKGVVGLVLPTGYSFNL
DGTAIYLSLAAVFIAQACNIDLSLGQVVTMLAIMLLSSKGAAGVTGSGFVALASTLTVIH
DIPLAGLALLIGVDRFMSEARALTSLASNAVATVVVSLSENACDRQTLHSRLNGEPVVTP
VAETADWVAEPHRHG