Protein Info for PP_2055 in Pseudomonas putida KT2440

Annotation: putative isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF04303: PrpF" amino acids 1 to 352 (352 residues), 412.7 bits, see alignment E=6.7e-128

Best Hits

Swiss-Prot: 62% identical to YBHH_SHIFL: Putative isomerase YbhH (ybhH) from Shigella flexneri

KEGG orthology group: K09788, hypothetical protein (inferred from 100% identity to ppu:PP_2055)

MetaCyc: 50% identical to 4-oxalomesaconate tautomerase (Pseudomonas putida KT2440)
RXN-9983 [EC: 5.3.2.8]

Predicted SEED Role

"FIG00958979: hypothetical protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L80 at UniProt or InterPro

Protein Sequence (359 amino acids)

>PP_2055 putative isomerase (Pseudomonas putida KT2440)
MQRIPCVLMRGGTSKGPFFHAWDLPANVVERDELLINLMGSGHELEIDGIGGGSPQTSKV
AIISPSLHADADVDYLFVQVMVAQRRVDTAPNCGNMLCAVGPFAIEQGLVKGQEGKTLVR
IRNLNTGTFVNSLVETPGGIVRYEGRTAIDGVPGTAAPVHLTFLDAVGSKTGKLFPTGKA
QDVIDGVPVTCIDMAMPMMVVEASQLGVSGSETPAQLDANSALLERLEALRLKAGKAMGL
GDVSGMVIPKPVLVSKPRYDGTLQVRYFMPHNCHRALAITGAVGLATACVSPGTVIADLL
GEGAQQLAQVRLEHPSGGIDVALTRSGAEGQTIQASVVRTARRLFSGFVYAPTFRRLAG