Protein Info for PP_2052 in Pseudomonas putida KT2440

Annotation: putative bifunctional enzyme: sugar-phosphatase/mannitol-1-phosphate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 707 PF13419: HAD_2" amino acids 13 to 191 (179 residues), 112.3 bits, see alignment E=7.5e-36 PF00702: Hydrolase" amino acids 13 to 184 (172 residues), 94.9 bits, see alignment E=2.1e-30 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 72 to 192 (121 residues), 51.1 bits, see alignment E=1.7e-17 PF13242: Hydrolase_like" amino acids 149 to 194 (46 residues), 22 bits, see alignment 3.1e-08 PF01232: Mannitol_dh" amino acids 250 to 415 (166 residues), 28 bits, see alignment E=5.2e-10 PF08125: Mannitol_dh_C" amino acids 512 to 668 (157 residues), 58.9 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2052)

Predicted SEED Role

"Phosphosugar isomerase / Mannitol-1-phosphate 5-dehydrogenase (EC 1.1.1.17)" in subsystem Mannitol Utilization (EC 1.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L83 at UniProt or InterPro

Protein Sequence (707 amino acids)

>PP_2052 putative bifunctional enzyme: sugar-phosphatase/mannitol-1-phosphate 5-dehydrogenase (Pseudomonas putida KT2440)
MLFFHGKQIFSAIFDMDGTLFDTERLRFRTLKQASLEIFGKALSEQTLIGSLGLSAKKAE
ALAKAHNGEDFPYAQIRQRADELELEYVRNHGVPIKAGLLEVLERLRKSGLTMAVATSSR
RAIAEEYLINANVLKYFDITVCGDEVGQGKPHPEIFLKAARALNCEPGQCFMVEDSENGM
LSAMRAEGQAILIEDIKPPAPEIKAGALKAYRSMHEFLADLSECVPDLGMPALSEPFPAS
MNQFSVGIHGFGAIGGGYLTQVFSHWDGYTRPREIIAATRSRMLRESVSAFGRYSVRYGA
TSFDQTIDNVRMIDMDDDDAVISMYTTAEIIGLSLPEQAIRSQARVIAQGLLQRFERRGR
ELTLLIVLNKVGGAAFVRRHVQAELSLLCPPAISEQVLQKTHFAETVVSRIVSKLGNDAL
VRQLRIKSQMFQNSLEDEPASTRKSSTPLPEYERLIGHFRPFAQPSSAMSQLHLVLFNSE
ADMPLYAERGSDLLERLRQVKTVPDIAQIQIIKNRLWNGPHAIVAWYASLLGHAWVGQGM
GDARVSELAERLIRQEVAPALVAEYPQMAEVVSRFAEAFLERCKTSFKDPCARVGRDPLR
KLQRNERILSSIDLARKHGIATPALAFGAGLAIHHALNCSNSKDLESQAIRQVYLDNQES
VEAVLTHANKPFPGLCPVKDAELIAAIREGFRQLPQPAPRHAVAVGS