Protein Info for PP_2040 in Pseudomonas putida KT2440

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 82 to 128 (47 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details amino acids 389 to 410 (22 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 284 (265 residues), 135.5 bits, see alignment E=1.1e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2040)

Predicted SEED Role

"FIG00954161: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L95 at UniProt or InterPro

Protein Sequence (431 amino acids)

>PP_2040 Major facilitator family transporter (Pseudomonas putida KT2440)
MTHTDTPARAGTAWMIAVLLALLMLVNFLDKVVIGLVAVPMSRELGLSPAEFGLVGGALH
WFFAISAVIGGFMANRRPTRTLLLGMGAFWALIQLPMLFVSSLWAIVACRVLLGIGEGPA
SPVATHALYKWFPNDRRNLPVALLHTGSALGLLVAGAMIPWISVHYGWRMNFIVLAVIGA
VWCVLWWRLGSEGNLDRIRPGQLEEGQAPVPYRRLLGDRTVLGNYLCHFAANWSLALTLT
WVPSYLETGLGIDPIMTGQVFVLFVVVTTPLSLFMAWLSQRMMRAGLATRWSRGAFVSVC
LIASGLLSAALFLPGLSNVERIVSLTFSGGLALVMYSVGPAMLAEFTPSGQRGGILAIGN
GIASLAGLSAPVVTGLLVQGAGAGHTAGFGQGFLVCGAVLVIAGLIGLAWMDPQKTRQRL
VQVGTAAPAQA