Protein Info for PP_2039 in Pseudomonas putida KT2440

Annotation: putative Acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 255 to 266 (12 residues), see Phobius details PF02771: Acyl-CoA_dh_N" amino acids 5 to 124 (120 residues), 36.6 bits, see alignment E=1e-12 PF02770: Acyl-CoA_dh_M" amino acids 129 to 223 (95 residues), 78.8 bits, see alignment E=5.8e-26 PF00441: Acyl-CoA_dh_1" amino acids 235 to 384 (150 residues), 170.6 bits, see alignment E=5.2e-54 PF08028: Acyl-CoA_dh_2" amino acids 251 to 369 (119 residues), 67.3 bits, see alignment E=3.5e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2039)

Predicted SEED Role

"Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.99.2)" in subsystem Isoleucine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L96 at UniProt or InterPro

Protein Sequence (388 amino acids)

>PP_2039 putative Acyl-CoA dehydrogenase (Pseudomonas putida KT2440)
MYQPSEKAQQIIEAISGFVRNEILPLEQQAGLSWAEPHPRAVLQQVWQRSCEQGFYNIML
PEAIGGAGLSVSDLCAVKEATVLTGSMLAPHILGELSGPPRIGHLFKVASPTQIEAFLQP
VCRAEKAVCFALTESEAGSDATAIKTSARREGEHYVLNGAKRYISGAPYADIAVLLAVTD
PGRGAQGISAFFVDLSAPGVRVESDYSVMSGGGAHGDIMLDDVRVPAANRIGEQGQGFKL
AMGRITLNRLLHCPTLLGLAGLALNLSIDYARTRKQFGQPIAMFQSINHMIADMATELHA
ARSMVYATAAVNDAGGNIRTQAPMCKLFVSETAFRIADRAVQIHGGAGLLRGNPVEWIFR
ATRMMRILTGTSEIQRNTIAKGVLMPEQ