Protein Info for PP_2029 in Pseudomonas putida KT2440

Annotation: von Willebrand factor type A domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 60 to 74 (15 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details PF00092: VWA" amino acids 91 to 280 (190 residues), 74.2 bits, see alignment E=3.1e-24 PF01882: DUF58" amino acids 91 to 204 (114 residues), 27.7 bits, see alignment E=3e-10 PF13519: VWA_2" amino acids 93 to 203 (111 residues), 68.2 bits, see alignment E=1.8e-22

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 99% identity to ppf:Pput_3713)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LA6 at UniProt or InterPro

Protein Sequence (358 amino acids)

>PP_2029 von Willebrand factor type A domain protein (Pseudomonas putida KT2440)
MFELAWPWVFALLPLPWLARLLLPAADSGEPVLKVGFLNELEGLAGRRARLNLPTWRQQA
PFVVIWLLLLCAAARPQWLGEPVPIAASGRDLLVAVDVSGSMDFPDMQWQNEDISRLDLV
KALMGDFLQDREGDRVGLILFGSQAYLQAPLTFDRRTVRTFLIEAQIGIAGKNTAIGDAI
GLAVKRLRERPAQSRVLVLITDGANNGGQIHPLTAARLAAQEGVRIYTIGIGANPEASGT
PGLLGLNPSLDLDEAALKEIADITHGAYFRAHDGAELDAIGDTLDQLEPVAQQPTQARTA
QALYAWPLALALLLSVLLVVAVQWPDNLLQRLLRKPRFLQPHPEWRQRLKRLRLRRRR