Protein Info for PP_2023 in Pseudomonas putida KT2440

Annotation: Glutathione S-transferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF02798: GST_N" amino acids 1 to 70 (70 residues), 48.9 bits, see alignment E=2.3e-16 PF00462: Glutaredoxin" amino acids 3 to 55 (53 residues), 23.1 bits, see alignment E=2.4e-08 PF13417: GST_N_3" amino acids 5 to 76 (72 residues), 66.2 bits, see alignment E=9.3e-22 PF13409: GST_N_2" amino acids 11 to 71 (61 residues), 61.8 bits, see alignment E=2.8e-20 PF00043: GST_C" amino acids 100 to 189 (90 residues), 25.9 bits, see alignment E=3.5e-09 PF14497: GST_C_3" amino acids 104 to 185 (82 residues), 22 bits, see alignment E=5.7e-08 PF13410: GST_C_2" amino acids 120 to 185 (66 residues), 44.5 bits, see alignment E=4.9e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2023)

Predicted SEED Role

"Glutathione S-transferase family protein" in subsystem Glutathione: Non-redox reactions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LB2 at UniProt or InterPro

Protein Sequence (199 amino acids)

>PP_2023 Glutathione S-transferase family protein (Pseudomonas putida KT2440)
MRVILYSFRRCPWAMRARLALRYAGCEVEICEVAMKNKPAELLALSPKGTVPVLDTGAEV
LGESLDIMRWALTQNDPQDWRLQANPAAAQQAETLIARNDTTFKAHVNLYKYAERYPEHS
REHYRQQAEAWLAELEGLLAGRAYLLADHPSMADAALLPLMRQFAGVEPQWFAEAAYPRV
RSWLEGWLASELFKAIMVR