Protein Info for PP_2014 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 96 to 121 (26 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details PF16733: NRho" amino acids 1 to 67 (67 residues), 103.7 bits, see alignment E=4.5e-34 PF01694: Rhomboid" amino acids 145 to 284 (140 residues), 108.9 bits, see alignment E=2.5e-35

Best Hits

KEGG orthology group: K02441, GlpG protein (inferred from 100% identity to ppu:PP_2014)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LC1 at UniProt or InterPro

Protein Sequence (295 amino acids)

>PP_2014 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MNIIEVMRLPLSVDLSGFVHLLQRLQVPHRVSEEGDAQVLWAPDTLAEDVLQLYQRYPDG
NADLPATADPVGAGAPANAPTQPSLAAQAKACKITTLTLLLCFIVAGLTGLGDNFTTISW
FTFLDFRVQGDYLYFSPLAQSLDEGQWWRLVSPMLLHFGVLHLAMNSLWYWELGKRIELR
QGPWALLGLTLLFSLVSNLAQHYTSGPSLFGGLSGVLYGLLGHIWLYQWLAPDRYFNLPK
GVLVMMLIWLVVCLTGVVGTLGLGQIANAAHVGGLLIGCLTGLLGGALARRKLSA