Protein Info for PP_1999 in Pseudomonas putida KT2440

Annotation: membrane protein required for colicin V production

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details PF02674: Colicin_V" amino acids 6 to 143 (138 residues), 121.8 bits, see alignment E=1.2e-39

Best Hits

KEGG orthology group: K03558, membrane protein required for colicin V production (inferred from 98% identity to ppg:PputGB1_1533)

Predicted SEED Role

"Colicin V production protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LD6 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PP_1999 membrane protein required for colicin V production (Pseudomonas putida KT2440)
MAFTLVDWAIIAIIAVSTLISLKRGFVKEALSLLIWIIAGAVAWMFGGSLSVYLESYIQT
PSMRIIAGCAILFVATLLVGAMVNFLVGELIRVTGLSGTDRFLGMAFGAARGALLVVVAI
GLISLGPVQQDTWWQESRLIPQFLLVADWSKNLILGFTDQWTPSGLISTPADLPFKEQLL
GPSKP