Protein Info for PP_1977 in Pseudomonas putida KT2440

Annotation: Glutamate--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to SYE_PSEPK: Glutamate--tRNA ligase (gltX) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 99% identity to ppg:PputGB1_1508)

Predicted SEED Role

No annotation

MetaCyc Pathways

adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
tRNA charging (20/21 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
superpathway of heme b biosynthesis from glutamate (9/10 steps found)
tetrapyrrole biosynthesis I (from glutamate) (6/6 steps found)
(2S,3E)-2-amino-4-methoxy-but-3-enoate biosynthesis (2/10 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LF6 at UniProt or InterPro

Protein Sequence (493 amino acids)

>PP_1977 Glutamate--tRNA ligase (Pseudomonas putida KT2440)
MTTVRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQIFD
ALRWLGIEWNEGPDVGGPHGPYRQSERGEIYAKYAKELVDAGHAFYCFCTAEELEQMRAE
QQARGETPRYDGRALLMSAEEVQRRLDAGEPHVIRMKVPSEGICVVPDMLRGDVEIPWDR
MDMQVLMKNDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPKLCY
MPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREKFSLAEMVEH
FDLSRISLGGPIFDIEKLSWLNGQWLRELPVEEFAARLQKWAFNSDYMMKIAPHVQGRVE
TFSQVAPLGGFFFEGALKLDAKLFESKKLSADQVRQVIQLILWKLESLRQWEKERITGCI
QAVVEALELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRYRLRQALDLLGGVSKK
ENKEWEKLLASIA