Protein Info for PP_1976 in Pseudomonas putida KT2440

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 45 to 65 (21 residues), see Phobius details PF25917: BSH_RND" amino acids 83 to 273 (191 residues), 41.6 bits, see alignment E=1.4e-14 PF25954: Beta-barrel_RND_2" amino acids 283 to 324 (42 residues), 26.8 bits, see alignment 7.3e-10

Best Hits

Swiss-Prot: 35% identical to EMRA_ACIBT: Colistin resistance protein EmrA (emrA) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to ppu:PP_1976)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LF7 at UniProt or InterPro

Protein Sequence (387 amino acids)

>PP_1976 HlyD family secretion protein (Pseudomonas putida KT2440)
MLAGGGHRAPAMARTSLVDGPCAAVKFVYISGTIVPMPAQLKRRLTLFFALVAIIALAFL
GHWYFKGRFYESTDNAYVQGEITRISSQLGARIETVPVEDNQHVSKGDLLVRLEAADFEL
AVERARAALATREAEYAQAQSRLTQQGSLIAAGQAQLAATQATFDRSRLDLSRAEKLRKP
GFVSEERVTTLSADSHVAGSQVDKARADLQSQRQQVTALNAELKRLDAQIANARTDLAQA
ELNLTRCEIHAPISGTIGQRNARNGQVVQAGAYLLSIVPDEDIWVQANFKETQIGRMHPG
QRAELLFDSYPDTPIEGRVDSLFAASGAQFSLLPPDNATGNFTKVVQRIPIKLTFHADNP
LHGRIRPGMSVTATVDLRSEDEGHNGR