Protein Info for PP_1962 in Pseudomonas putida KT2440

Annotation: Site-specific recombinase, phage integrase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 transmembrane" amino acids 511 to 527 (17 residues), see Phobius details PF00589: Phage_integrase" amino acids 287 to 452 (166 residues), 58.9 bits, see alignment E=2.9e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1962)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LH0 at UniProt or InterPro

Protein Sequence (642 amino acids)

>PP_1962 Site-specific recombinase, phage integrase family (Pseudomonas putida KT2440)
MQETAGELESSKSGLLIKLLTLPGGDFPVSLESEFRDSIWKLADTTQSACNIRFDREIPG
GNDLKRAIVYHLLPAFTPFNRIRSFVSSKAKSHDYRFIEIYLLGPNRLSAIPEHLDLITN
PMLNRALDDAKASGQPSHYSGLFFMLRFWLSLSLNKLIPESLRLPEHITSFDSHERHKDV
LDNFKGSIQSWVPLSEEDLEKVVTEALFWLEKAIPRLLDLRQYIIENKIDQYEKGKVYSP
TRQPDYEKILHIEIDGRKVSSFSITTSRNRNSIRYAYSWVIEYAQAIDKVRNAVFVFVAL
VTGMRKSELGGLKFDDITQDEAGLYWIDITRYKTSNDPNYNGETERLPLPKFVGETIKSL
RTLRSTWTFYREGFIFQSASSSIKVTKGVPQLPNTIIDYLEEVTGIERLHPHRFRKTIAE
ILINRSERNIDLIRLLFGHHSYEMTLRYISRNPYMVRSVAMALEESFSKEFHEIVTAVRD
GTHSGPGADRLAKQIVTRPDDFKGKRLKLSILVYVSHLLSAGSPLYVGRTAMGTYCMSGE
EFDETNLPPCLAGRPRPKGRLLPDPTNCQVECHNAVVLGKAETAMKDNIHFYEQLLENAD
DSVSAKARRKIQAKIDAHKRHLLNLHDNAHTKALRIPVLEVS