Protein Info for PP_1930 in Pseudomonas putida KT2440

Annotation: arsenic resistance transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 PF12840: HTH_20" amino acids 24 to 72 (49 residues), 29.6 bits, see alignment E=5.7e-11 PF01022: HTH_5" amino acids 26 to 70 (45 residues), 55.2 bits, see alignment E=5.3e-19

Best Hits

Swiss-Prot: 100% identical to ARSR1_PSEPK: Arsenic resistance transcriptional regulator ArsR1 (arsR1) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 100% identity to ppu:PP_1930)

MetaCyc: 46% identical to DNA-binding transcriptional repressor ArsR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Arsenical resistance operon repressor" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LK1 at UniProt or InterPro

Protein Sequence (128 amino acids)

>PP_1930 arsenic resistance transcriptional regulator (Pseudomonas putida KT2440)
MAVRAFPGGHMREILTPPIVFKCLADDTRARMTLLIAREGELCVCELTHALELSQPKISR
HLAQLREAGILMDRRKGQWVYYRLHPEVPQWVDAMLKGVVDANQEWLSPDALRLAEMGER
PQSPVACA