Protein Info for PP_1918 in Pseudomonas putida KT2440

Annotation: septation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR00247: conserved hypothetical protein, YceG family" amino acids 13 to 340 (328 residues), 267.7 bits, see alignment E=7.3e-84 PF02618: YceG" amino acids 54 to 339 (286 residues), 283.2 bits, see alignment E=1.2e-88

Best Hits

KEGG orthology group: K07082, UPF0755 protein (inferred from 100% identity to ppu:PP_1918)

Predicted SEED Role

"FIG004453: protein YceG like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LL2 at UniProt or InterPro

Protein Sequence (421 amino acids)

>PP_1918 septation protein (Pseudomonas putida KT2440)
MPVRYWKPEFVRRKFLLLLEMGLILAGLAFGWSAWKVNSVLEQPLHITQERLLDVPNGTN
PNRMFYSMQREGLLDDAVWLRLYWRFNMAGTPLHTGEYRLTPGMTVEQLFDAWRRADVVQ
YNLTLVEGWTFRQVRAAVAKHEKIKHTLEGLSDAEVMDKLGHTGVFPEGRFFPDTYRFVR
GMSDVELLQQAYMRLDEVLAKEWAERSTDLPYRDPYQALIMASLVEKETGIPQERGQIAG
VFVRRMRLGMMLQTDPTVIYGMGERYNGRITRADLREPTPYNTYTMTGLPPTPIAMVGRE
AIHAALNPSNGTSLYFVARGDGSHVFSDDLDDHNSAVREFQLKRRSDYRSSPAPQQEAKP
GADDAEQASGADDAQRPEPPAADPSATDEPTAQPAPDEAPAQDAPAGGAQAAERPTPDEQ
H